PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G1078
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 205aa    MW: 23289.3 Da    PI: 7.5838
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G1078genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-16550348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd ll+++++++G g W++I+   g++R++k+c++rw++yl
      Gh_D13G1078  5 AWTEEEDYLLKKCIERYGEGKWHRIPVLAGLKRCRKSCRLRWLNYL 50
                     7*******************************************97 PP

2Myb_DNA-binding39.51.3e-1256109147
                      TSSS-HHHHHHHHHHHHHTTTT........-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg........tWktIartmgkgRtlkqcksrwqky 47 
                      rg++ +eE  l+++++ +lG++         W++Ia +++ gRt++++k++w+ +
      Gh_D13G1078  56 RGSFAAEEVNLIINLHSLLGNRhafhsiklMWSLIAGRLP-GRTANDVKNYWNCH 109
                      78999***********************************.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.192154IPR017930Myb domain
SMARTSM007173.5E-13252IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-21557IPR009057Homeodomain-like
SuperFamilySSF466891.14E-235106IPR009057Homeodomain-like
PfamPF002496.9E-15550IPR001005SANT/Myb domain
CDDcd001677.25E-11550No hitNo description
PROSITE profilePS5129412.48855114IPR017930Myb domain
SMARTSM007173.6E-855112IPR001005SANT/Myb domain
PfamPF002491.3E-1056107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2158115IPR009057Homeodomain-like
CDDcd001671.75E-761110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MGGVAWTEEE DYLLKKCIER YGEGKWHRIP VLAGLKRCRK SCRLRWLNYL RPNIKRGSFA  60
AEEVNLIINL HSLLGNRHAF HSIKLMWSLI AGRLPGRTAN DVKNYWNCHL SKKLNSAPQS  120
EDDQTAAATT TASMKPRRPA HVSPNTQPET SVWAPFHDVQ VNQQGQEVAA EEPGTLVGDL  180
EFDEGGSSKW WDDFIFDMDL WTASL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-19611610110B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464849.11e-135PREDICTED: transcription factor MYB114-like isoform X1
TrEMBLA0A0D2SCI41e-135A0A0D2SCI4_G
STRINGGLYMA18G41520.11e-67(Glycine max)
STRINGGLYMA07G16980.11e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17352611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.19e-52myb domain protein 113